GACS will never ask for your seed phrase, private keys, or payment. Always free.
CONFIRMED SCAM

ScamSniffer: vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh.site

vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh.site

CRITICAL risk
WEBSITE
0 reports
Critical riskGACS Risk Score

Composite score from 4 signals below.

  • In GACS scam database+40
  • On active blacklist+30
  • Critical severity+15
  • Confirmed by scamsniffer+5
Why we flagged this
Active 27dwebsitescamsnifferOn active blacklist

Don't get hit by this twice.

Activate your free Shield to get instant alerts when this scam — or anything like it — comes back.

Next 5 minutes — what to do right now

Most damage from this scam type happens in the first hour. Knock these out in order.

  1. 1
    Verify the exact identifier

    Paste the website, wallet, phone, or social handle into the free checker. You'll see every report tied to it in seconds.

    Run a free check
  2. 2
    Change any password you entered

    If you typed a password on this site, change it everywhere you reused it. Phishing sites resell credentials within hours.

    Open the 15-min panic guide
  3. 3
    Save it to your Shield

    Activating your free Shield gives you alerts if this scammer surfaces again under a new handle, domain, or wallet.

    Activate my free Shield
  4. 4
    Report what you saw

    Even a 30-second report makes the next victim's lookup land here. Anonymous is fine.

    File a report
  5. 5
    Warn one person you know

    The fastest way to neutralize an active scam: send this page to one friend or family member who fits the target profile.

    Get the family playbook

Know someone who could fall for this? Warn them now.

One tap to send the verdict — and a safety disclaimer — before they send money.

WhatsAppText itPost on X
Check another — instant verdict

Free · no signup · cross-referenced against 1,700+ confirmed scams.

Related scam alert hubs

Live feeds for this scam's category and region.

Listed here and believe this is wrong? Submit an appeal. A human reviews each one and the listing is not re-scanned while an appeal is open.

Check another handle, link or wallet

Paste any X/Telegram handle, website, or crypto wallet. Free, no signup, 5-second verdict.

Get alerts when similar scams emerge

You just helped flag a scam. Create a free GACS account to receive an alert the next time a wallet, domain, or handle matching this pattern is reported.

Create free account
100
Danger / 100

GACS verdict: Do not engage

  • Listed on the GACS active blacklist (multi-source confirmed).
  • Severity classified as CRITICAL based on harm pattern.
  • Cross-referenced against external feed: scamsniffer.
  • Tactic category: website.
First flagged Jun 7, 2026Last verified Jun 7, 2026How we score
Help others avoid this — share takes one tap.

What we know

Crypto drainer / phishing domain flagged by ScamSniffer

Identifiers flagged

  • Website
    vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh.site

Timeline

First reported
6/7/2026
Last activity
6/7/2026
Source
scamsniffer
Status
Confirmed scam
Source

Scan a suspicious link

Got a sketchy link in a DM, email or SMS? Expand and scan it with the free scam link checker before you open it.

Related scam alert hubs

Live, updating feeds tied to this scam's category and region — playbooks, red flags, and how to report.

Browse scams by country

Reports from people in your region — local helplines, currency-specific tactics, and "saved from loss" stories.

How GACS compares

See how this free scam registry stacks up against the major alternatives.

Cite this page / Press kit

Journalists, researchers and educators are welcome to cite this page. Use the permalink below or copy a ready-made citation.

Permalinkhttps://gacs.app/scam/scamsniffer-vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh-site-4663dd
APA

GACS. (2026). ScamSniffer: vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh.site — GACS scam report. GACS — Global Anti-Crime & Safety. Retrieved July 4, 2026, from https://gacs.app/scam/scamsniffer-vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh-site-4663dd

MLA

"ScamSniffer: vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh.site — GACS scam report." GACS — Global Anti-Crime & Safety, GACS, 2026, https://gacs.app/scam/scamsniffer-vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh-site-4663dd. Accessed July 4, 2026.

Chicago

GACS. "ScamSniffer: vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh.site — GACS scam report." GACS — Global Anti-Crime & Safety. Accessed July 4, 2026. https://gacs.app/scam/scamsniffer-vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh-site-4663dd.

BibTeX
@misc{gacs_scam_scamsniffer_vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh_site_4663dd,
  author = {GACS},
  title = {ScamSniffer: vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh.site — GACS scam report},
  howpublished = {GACS — Global Anti-Crime & Safety},
  year = {2026},
  note = {Accessed: July 4, 2026},
  url = {https://gacs.app/scam/scamsniffer-vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh-site-4663dd}
}

Press / media enquiries: About GACS · Editorial policy · Methodology

GACS · free, community-verified scam intelligence · see all alerts