ScamSniffer: niftygatewaymarketplace.net
niftygatewaymarketplace.net
Composite score from 4 signals below.
- In GACS scam database+40
- On active blacklist+30
- Critical severity+15
- Confirmed by scamsniffer+5
Next 5 minutes — what to do right now
Most damage from this scam type happens in the first hour. Knock these out in order.
- 1Verify the exact identifier
Paste the website, wallet, phone, or social handle into the free checker. You'll see every report tied to it in seconds.
Run a free check - 2Change any password you entered
If you typed a password on this site, change it everywhere you reused it. Phishing sites resell credentials within hours.
Open the 15-min panic guide - 3Save it to your Shield
Activating your free Shield gives you alerts if this scammer surfaces again under a new handle, domain, or wallet.
Activate my free Shield - 4Report what you saw
Even a 30-second report makes the next victim's lookup land here. Anonymous is fine.
File a report - 5Warn one person you know
The fastest way to neutralize an active scam: send this page to one friend or family member who fits the target profile.
Get the family playbook
Check another handle, link or wallet
Paste any X/Telegram handle, website, or crypto wallet. Free, no signup, 5-second verdict.
You just helped flag a scam. Create a free GACS account to receive an alert the next time a wallet, domain, or handle matching this pattern is reported.
Create free accountGACS verdict: Do not engage
- Listed on the GACS active blacklist (multi-source confirmed).
- Severity classified as CRITICAL based on harm pattern.
- Cross-referenced against external feed: scamsniffer.
- Tactic category: website.
What we know
Crypto drainer / phishing domain flagged by ScamSniffer
Identifiers flagged
- Websiteniftygatewaymarketplace.net
Got hit by this scam?
You're not alone. Take action now — every minute counts.
US victims — file with the FTC & FBI's IC3
Step-by-step reporting guide that walks you through both filings in under 15 minutes — what evidence to bring and how to navigate each official form.Verify a website's authenticity
Not sure if a site is legit? Use the free website authenticity check to see the signals before you click, pay or sign up.
Related scam alert hubs
Live, updating feeds tied to this scam's category and region — playbooks, red flags, and how to report.
Browse scams by country
Reports from people in your region — local helplines, currency-specific tactics, and "saved from loss" stories.
Cite this page / Press kit
Journalists, researchers and educators are welcome to cite this page. Use the permalink below or copy a ready-made citation.
https://gacs.app/scam/scamsniffer-niftygatewaymarketplace-net-33defb- APA
GACS. (2026). ScamSniffer: niftygatewaymarketplace.net — GACS scam report. GACS — Global Anti-Crime & Safety. Retrieved June 30, 2026, from https://gacs.app/scam/scamsniffer-niftygatewaymarketplace-net-33defb
- MLA
"ScamSniffer: niftygatewaymarketplace.net — GACS scam report." GACS — Global Anti-Crime & Safety, GACS, 2026, https://gacs.app/scam/scamsniffer-niftygatewaymarketplace-net-33defb. Accessed June 30, 2026.
- Chicago
GACS. "ScamSniffer: niftygatewaymarketplace.net — GACS scam report." GACS — Global Anti-Crime & Safety. Accessed June 30, 2026. https://gacs.app/scam/scamsniffer-niftygatewaymarketplace-net-33defb.
- BibTeX
@misc{gacs_scam_scamsniffer_niftygatewaymarketplace_net_33defb, author = {GACS}, title = {ScamSniffer: niftygatewaymarketplace.net — GACS scam report}, howpublished = {GACS — Global Anti-Crime & Safety}, year = {2026}, note = {Accessed: June 30, 2026}, url = {https://gacs.app/scam/scamsniffer-niftygatewaymarketplace-net-33defb} }
Press / media enquiries: About GACS · Editorial policy · Methodology
